General Information

  • ID:  hor005614
  • Uniprot ID:  Q7Q7R8
  • Protein name:  Neuropeptide F
  • Gene name:  npf
  • Organism:  Anopheles gambiae (African malaria mosquito)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Expressed both maternally and zygotically in larvae, pupae, and the heads of adults.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  gambiae species complex, Pyretophorus, Cellia (subgenus), Anopheles (genus), Anophelinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007586 digestion; GO:0032095 regulation of response to food; GO:0035176 social behavior; GO:0035177 larval foraging behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RPQDSDAASVAAAIRYLQELETKHAQHARPRF
  • Length:  32(30-61)
  • Propeptide:  MASGTFTQRLLVALMIFALIADLSTLVAARPQDSDAASVAAAIRYLQELETKHAQHARPRFGKRGGYLNPAIFGQDEQEVDWQDSTFSR
  • Signal peptide:  MASGTFTQRLLVALMIFALIADLSTLVAA
  • Modification:  T32 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  An integral part of the sensory system that mediates food signaling, providing the neural basis for the regulation of food response; coordinates larval foraging and social behavior changes during development. May have a hormonal role in females
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-V9QFH5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005614_AF2.pdbhor005614_ESM.pdb

Physical Information

Mass: 418717 Formula: C157H250N52O48
Absent amino acids: CGMNW Common amino acids: A
pI: 9.3 Basic residues: 7
Polar residues: 4 Hydrophobic residues: 12
Hydrophobicity: -87.19 Boman Index: -9729
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 67.5
Instability Index: 5127.5 Extinction Coefficient cystines: 1490
Absorbance 280nm: 48.06

Literature

  • PubMed ID:  15626509
  • Title:  Characterization of neuropeptide F and its receptor from the African malaria mosquito, Anopheles gambiae.
  • PubMed ID:  12364794
  • Title:  Neuropeptides and peptide hormones in Anopheles gambiae.